PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG128700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 141aa    MW: 15335.2 Da    PI: 4.9007
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG128700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.78.3e-5418114298
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          +eqdr+lPian++rim++++P n+ki+kdake+vqecvsefisf+tseasdkc +ekrktingddl+w+l+tlGfe+yveplk ylk yr
  Pavir.1KG128700.2.p  18 KEQDRYLPIANIGRIMRRAVPDNGKIAKDAKESVQECVSEFISFITSEASDKCMKEKRKTINGDDLIWSLGTLGFEEYVEPLKHYLKLYR 107
                          89**************************************************************************************** PP

                NF-YB  92 elegekk 98 
                          e+eg++k
  Pavir.1KG128700.2.p 108 ETEGDTK 114
                          ****975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.3E-5016123IPR009072Histone-fold
SuperFamilySSF471138.69E-3820120IPR009072Histone-fold
PfamPF008089.1E-272386IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.4E-195169No hitNo description
PROSITE patternPS0068505470IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.4E-197088No hitNo description
PRINTSPR006155.4E-1989107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MSEAESAPET GGGSYGGKEQ DRYLPIANIG RIMRRAVPDN GKIAKDAKES VQECVSEFIS  60
FITSEASDKC MKEKRKTING DDLIWSLGTL GFEEYVEPLK HYLKLYRETE GDTKGSKSSD  120
HTGKKEIVLI GEPGSSLDGV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4518108393NF-YB
4csr_A1e-4518108494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-4518108494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.192640.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1016331e-123FP101633.1 Phyllostachys edulis cDNA clone: bphyst004h13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699849.19e-79PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotQ65XK11e-73NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0A9PIF88e-84A0A0A9PIF8_ARUDO; Uncharacterized protein
STRINGSi024597m3e-74(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.35e-60nuclear factor Y, subunit B1